Anti-alpha Parvin

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59459.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Plays a role in sarcomere organization and in smooth muscle cell contraction.... more
Product information "Anti-alpha Parvin"
Protein function: Plays a role in sarcomere organization and in smooth muscle cell contraction. Required for normal development of the embryonic cardiovascular system, and for normal septation of the heart outflow tract. Plays a role in sprouting angiogenesis and is required for normal adhesion of vascular smooth muscle cells to endothelial cells during blood vessel development. Plays a role in the reorganization of the actin cytoskeleton, formation of lamellipodia and ciliogenesis. Plays a role in the establishement of cell polarity, cell adhesion, cell spreading, and directed cell migration. [The UniProt Consortium]
Keywords: Anti-PARVA, Anti-MXRA2, Anti-CH-ILKBP, Anti-Actopaxin, Anti-Alpha-parvin, Anti-Matrix-remodeling-associated protein 2, Anti-Calponin-like integrin-linked kinase-binding protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59459

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat (Expected: mouse, hamster)
Immunogen: Synthetic peptide corresponding to aa. 155-185 of Human alpha Parvin. (QKLQTVLEKINETLKLPPRSIKWNVDSVHAK)
MW: 42 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-alpha Parvin"
Write a review
or to review a product.
Viewed