Anti-Parvin alpha / PARVA

Anti-Parvin alpha / PARVA
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32338 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Parvin alpha is a protein that in humans... more
Product information "Anti-Parvin alpha / PARVA"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival. Protein function: Plays a role in sarcomere organization and in smooth muscle cell contraction. Required for normal development of the embryonic cardiovascular system, and for normal septation of the heart outflow tract. Plays a role in sprouting angiogenesis and is required for normal adhesion of vascular smooth muscle cells to endothelial cells during blood vessel development. Plays a role in the reorganization of the actin cytoskeleton, formation of lamellipodia and ciliogenesis. Plays a role in the establishement of cell polarity, cell adhesion, cell spreading, and directed cell migration. [The UniProt Consortium]
Keywords: Anti-MXRA2, Anti-PARVA, Anti-CH-ILKBP, Anti-Actopaxin, Anti-Alpha-parvin, Anti-Matrix-remodeling-associated protein 2, Anti-Calponin-like integrin-linked kinase-binding protein, Parvin alpha Antibody / PARVA
Supplier: NSJ Bioreagents
Supplier-Nr: R32338

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QKLQTVLEKINETLKLPPRSIKWNVDSVHAK of human Parvin alpha were used as the immunogen for the PARVA antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Parvin alpha / PARVA"
Write a review
or to review a product.
Viewed