Anti-ZP2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59230.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: The mammalian zona pellucida, which mediates species- specific sperm binding,... more

Close menu

Product information "Anti-ZP2"

Protein function: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor. [The UniProt Consortium]

Keywords:	Anti-ZPA, Anti-ZP2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59230

Properties

Application:	IHC (frozen), IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat)
Immunogen:	Synthetic peptide corresponding to aa. 511-544 of Human ZP2. (ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD)
MW:	82 kD
Format:	Antigen Affinity Purified