Anti-ZP2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32192 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zona pellucida sperm-binding protein 2 is... more
Product information "Anti-ZP2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zona pellucida sperm-binding protein 2 is a protein that in humans is encoded by the ZP2 gene. The sperm-binding domain on the ZP2 protein is necessary in both humans and mice for oocyte-sperm recognition and penetration of the zona pellucida. It is also responsible for the primary block to polyspermy in mammals. The oocyte has cortical granules peripherally located under the cortex that contain a proteolytic protein called ovastacin. After the sperm binds to ZP2, the cortical granules are exocytosed releasing ovastacin into the perivitelline space. Ovastacin cleaves ZP2 at the N terminus, preventing more sperm from binding and penetrating the oocyte, thus hardening the zona pellucida. Ovastacin is only found in oocytes, and is part of the astacin family of metalloendoproteases. Female mice engineered without ovastacin showed that ZP2 was not cleaved after fertilization. Protein function: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor. [The UniProt Consortium]
Keywords: Anti-ZP2, Anti-ZPA, ZP2 Antibody
Supplier-Nr: R32192

Properties

Application: WB, IHC (paraffin), IHC (frozen)
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human
Immunogen: Amino acids ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD of human ZP2 were used as the immunogen for the ZP2 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ZP2"
Write a review
or to review a product.
Viewed