Anti-TGF beta Receptor 1

Anti-TGF beta Receptor 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG57752.50 50 µg - -

6 - 14 business days*

528.00€
 
Protein function: Transmembrane serine/threonine kinase forming with the TGF-beta type II... more
Product information "Anti-TGF beta Receptor 1"
Protein function: Transmembrane serine/threonine kinase forming with the TGF-beta type II serine/threonine kinase receptor, TGFBR2, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non- canonical, SMAD-independent TGF-beta signaling pathways. For instance, TGFBR1 induces TRAF6 autoubiquitination which in turn results in MAP3K7 ubiquitination and activation to trigger apoptosis. Also regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway through PARD6A phosphorylation and activation. [The UniProt Consortium]
Keywords: Anti-SKR4, Anti-ALK5, Anti-ALK-5, Anti-TGFBR1, Anti-TGFR-1, Anti-TbetaR-I, EC=2.7.11.30, Anti-TGF-beta receptor type I, Anti-TGF-beta receptor type-1, Anti-TGF-beta type I receptor, Anti-Activin receptor-like kinase 5
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG57752

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide around aa. 149-186 of Human TGF beta Receptor 1. (HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT)
MW: 56 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TGF beta Receptor 1"
Write a review
or to review a product.
Viewed