Anti-SOX5

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59127.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of... more

Close menu

Product information "Anti-SOX5"

Protein function: Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of COL2A1 and AGC1 in vitro. [The UniProt Consortium]

Keywords:	Anti-SOX5, Anti-Transcription factor SOX-5
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59127

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat, swine (Expected: mouse, bovine)
Immunogen:	Synthetic peptide corresponding to aa. 495-528 of Human SOX5. (EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS)
MW:	84 kD
Format:	Antigen Affinity Purified