Anti-SOX5

Anti-SOX5
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32081 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transcription factor SOX-5 is a protein... more
Product information "Anti-SOX5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Protein function: Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of COL2A1 and AGC1 in vitro. [The UniProt Consortium]
Keywords: Anti-SOX5, Anti-Transcription factor SOX-5, SOX5 Antibody
Supplier-Nr: R32081

Properties

Application: WB
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Rat
Immunogen: Amino acids EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS of human SOX5 were used as the immunogen for the SOX5 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SOX5"
Write a review
or to review a product.
Viewed