Anti-RAB14

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59337.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Involved in membrane trafficking between the Golgi complex and endosomes during... more

Close menu

Product information "Anti-RAB14"

Protein function: Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes. Regulates, together with its guanine nucleotide exchange factor DENND6A, the specific endocytic transport of ADAM10, N- cadherin/CDH2 shedding and cell-cell adhesion. [The UniProt Consortium]

Keywords:	Anti-RAB14, Anti-Ras-related protein Rab-14
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59337

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat (Expected: hamster)
Immunogen:	Synthetic peptide corresponding to aa. 124-153 of Human RAB14. (NKADLEAQRDVTYEEAKQFAEENGLLFLEA)
MW:	24 kD
Format:	Antigen Affinity Purified