Anti-RAB14

Anti-RAB14
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32156 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ras-related protein Rab-14 is a protein... more
Product information "Anti-RAB14"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene. It is mapped to 9q33.2 based on an alignment of the RAB14 sequence with the genomic sequence. RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes. Protein function: Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes. Regulates, together with its guanine nucleotide exchange factor DENND6A, the specific endocytic transport of ADAM10, N- cadherin/CDH2 shedding and cell-cell adhesion. [The UniProt Consortium]
Keywords: Anti-RAB14, Anti-Ras-related protein Rab-14, RAB14 Antibody
Supplier-Nr: R32156

Properties

Application: WB
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Rat
Immunogen: Amino acids NKADLEAQRDVTYEEAKQFAEENGLLFLEA of human RAB14 were used as the immunogen for the RAB14 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RAB14"
Write a review
or to review a product.
Viewed