Anti-Platelet Derived Growth Factor Receptor alpha / PDGFRA

Anti-Platelet Derived Growth Factor Receptor alpha / PDGFRA
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31979 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PDGFRA (Platelet-derived growth factor... more
Product information "Anti-Platelet Derived Growth Factor Receptor alpha / PDGFRA"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PDGFRA (Platelet-derived growth factor receptor, alpha), also called PDGFR2 and CD140a, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The PDGFA gene is mapped on 4q12. The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib. And the PDGFRA gene contains 23 exons spanning about 65 kb. Using the human PDGFRA promoter linked to a luciferase reporter, Joosten et al. showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in differentiated human embryonal carcinoma cells. PDGFRA is responsible for mediating cellular contraction of multiple growth factors: TGFB1 and members of the PDGF family. Lei et al. noted that in the rabbit model of the disease, PDGFRA is dramatically more capable of promoting PVR than is the closely related PDGFRB. PDGFRA is a critical receptor required for human CMV infection, and thus a target for novel antiviral therapies. Protein function: Tyrosine-protein kinase that acts as a cell-surface receptor for PDGFA, PDGFB and PDGFC and plays an essential role in the regulation of embryonic development, cell proliferation, survival and chemotaxis. Depending on the context, promotes or inhibits cell proliferation and cell migration. Plays an important role in the differentiation of bone marrow-derived mesenchymal stem cells. Required for normal skeleton development and cephalic closure during embryonic development. Required for normal development of the mucosa lining the gastrointestinal tract, and for recruitment of mesenchymal cells and normal development of intestinal villi. Plays a role in cell migration and chemotaxis in wound healing. Plays a role in platelet activation, secretion of agonists from platelet granules, and in thrombin-induced platelet aggregation. Binding of its cognate ligands - homodimeric PDGFA, homodimeric PDGFB, heterodimers formed by PDGFA and PDGFB or homodimeric PDGFC -leads to the activation of several signaling cascades, the response depends on the nature of the bound ligand and is modulated by the formation of heterodimers between PDGFRA and PDGFRB. Phosphorylates PIK3R1, PLCG1, and PTPN11. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, mobilization of cytosolic Ca(2+) and the activation of protein kinase C. Phosphorylates PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and thereby mediates activation of the AKT1 signaling pathway. Mediates activation of HRAS and of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3 and STAT5A and/or STAT5B. Receptor signaling is down-regulated by protein phosphatases that dephosphorylate the receptor and its down-stream effectors, and by rapid internalization of the activated receptor. [The UniProt Consortium]
Keywords: Anti-CD140a, Anti-PDGFR2, Anti-PDGFRA, Anti-PDGFR-2, EC=2.7.10.1, Anti-PDGFR-alpha, Anti-PDGF-R-alpha, Anti-CD140a antigen, Anti-CD140 antigen-like family member A, Anti-Platelet-derived growth factor receptor 2, Platelet Derived Growth Factor Receptor al
Supplier: NSJ Bioreagents
Supplier-Nr: R31979

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD of human PDGFRA were used as the immunogen for the PDGFR alpha antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Platelet Derived Growth Factor Receptor alpha / PDGFRA"
Write a review
or to review a product.
Viewed