Anti-PIK3CB / p110 beta

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59884.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Phosphoinositide-3-kinase (PI3K) that phosphorylates PtdIns... more
Product information "Anti-PIK3CB / p110 beta"
Protein function: Phosphoinositide-3-kinase (PI3K) that phosphorylates PtdIns (Phosphatidylinositol), PtdIns4P (Phosphatidylinositol 4- phosphate) and PtdIns(4,5)P2 (Phosphatidylinositol 4,5- bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Involved in the activation of AKT1 upon stimulation by G-protein coupled receptors (GPCRs) ligands such as CXCL12, sphingosine 1-phosphate, and lysophosphatidic acid. May also act downstream receptor tyrosine kinases. Required in different signaling pathways for stable platelet adhesion and aggregation. Plays a role in platelet activation signaling triggered by GPCRs, alpha-IIb/beta-3 integrins (ITGA2B/ ITGB3) and ITAM (immunoreceptor tyrosine-based activation motif)-bearing receptors such as GP6. Regulates the strength of adhesion of ITGA2B/ ITGB3 activated receptors necessary for the cellular transmission of contractile forces. Required for platelet aggregation induced by F2 (thrombin) and thromboxane A2 (TXA2). Has a role in cell survival. May have a role in cell migration. Involved in the early stage of autophagosome formation. Modulates the intracellular level of PtdIns3P (Phosphatidylinositol 3-phosphate) and activates PIK3C3 kinase activity. May act as a scaffold, independently of its lipid kinase activity to positively regulate autophagy. May have a role in insulin signaling as scaffolding protein in which the lipid kinase activity is not required. May have a kinase-independent function in regulating cell proliferation and in clathrin-mediated endocytosis. Mediator of oncogenic signal in cell lines lacking PTEN. The lipid kinase activity is necessary for its role in oncogenic transformation. Required for the growth of ERBB2 and RAS driven tumors. [The UniProt Consortium]
Keywords: Anti-PIK3C1, Anti-PIK3CB, Anti-p110beta, Anti-PI3Kbeta, Anti-PI3K-beta, EC=2.7.1.153, Anti-PI3-kinase subunit beta, Anti-PtdIns-3-kinase subunit beta, Anti-PtdIns-3-kinase subunit p110-beta, Anti-Phosphatidylinositol 4
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59884

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 556-598 of Human PIK3CB. (DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW)
MW: 123 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PIK3CB / p110 beta"
Write a review
or to review a product.
Viewed