Anti-Periplakin

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59019.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Component of the cornified envelope of keratinocytes. May link the cornified... more

Close menu

Product information "Anti-Periplakin"

Protein function: Component of the cornified envelope of keratinocytes. May link the cornified envelope to desmosomes and intermediate filaments. May act as a localization signal in PKB/AKT-mediated signaling. [The UniProt Consortium]

Keywords:	Anti-PPL, Anti-KIAA0568, Anti-Periplakin, Anti-190 kDa paraneoplastic pemphigus antigen, Anti-195 kDa cornified envelope precursor protein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59019

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 1664-1701 of Human Periplakin (DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK)
MW:	205 kD
Format:	Antigen Affinity Purified