Anti-NR3C2 / Mineralocorticoid Receptor

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59039.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Receptor for both mineralocorticoids (MC) such as aldosterone and... more

Close menu

Product information "Anti-NR3C2 / Mineralocorticoid Receptor"

Protein function: Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels. [The UniProt Consortium]

Keywords:	Anti-MR, Anti-MCR, Anti-NR3C2, Anti-Mineralocorticoid receptor, Anti-Nuclear receptor subfamily 3 group C member 2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59039

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat (Expected: chicken)
Immunogen:	Synthetic peptide corresponding to aa. 950-984 of Human NR3C2 (HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK)
MW:	107 kD
Format:	Antigen Affinity Purified