Anti-Mineralocorticoid Receptor / MR

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31912 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NR3C2 (nuclear receptor subfamily 3, group... more
Product information "Anti-Mineralocorticoid Receptor / MR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants. Protein function: Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels. [The UniProt Consortium]
Keywords: Anti-MR, Anti-MCR, Anti-NR3C2, Anti-Mineralocorticoid receptor, Anti-Nuclear receptor subfamily 3 group C member 2, Mineralocorticoid Receptor Antibody / MR
Supplier: NSJ Bioreagents
Supplier-Nr: R31912

Properties

Application: WB, IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: amino acids HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK of the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Mineralocorticoid Receptor / MR"
Write a review
or to review a product.
Viewed