Anti-MDR1 / P Glycoprotein 1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40826.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Energy-dependent efflux pump responsible for decreased drug accumulation in... more

Close menu

Product information "Anti-MDR1 / P Glycoprotein 1"

Protein function: Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. [The UniProt Consortium]

Keywords:	Anti-MDR1, Anti-ABCB1, Anti-CD243, EC=7.6.2.2, Anti-P-glycoprotein 1, Anti-Multidrug resistance protein 1, Anti-ATP-binding cassette sub-family B member 1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40826

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat)
Immunogen:	Synthetic peptide corresponding to a sequence of Human P Glycoprotein 1. (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY)
MW:	141 kD