Anti-Lysozyme

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40281.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Lysozymes have primarily a bacteriolytic function, those in tissues and body... more

Close menu

Product information "Anti-Lysozyme"

Protein function: Lysozymes have primarily a bacteriolytic function, those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents. [The UniProt Consortium]

Keywords:	Anti-LYZ, Anti-LZM, Anti-Lysozyme C, EC=3.2.1.17, Anti-1,4-beta-N-acetylmuramidase C
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40281

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Synthetic peptide corresponding to aa. 106-141 of Human Lysozyme. (NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ)
MW:	16.5 kD
Format:	Antigen Affinity Purified