Anti-Lysozyme / LYZ

Anti-Lysozyme / LYZ
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32157 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. In humans, the lysozyme enzyme is encoded... more
Product information "Anti-Lysozyme / LYZ"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. Protein function: Lysozymes have primarily a bacteriolytic function, those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents. [The UniProt Consortium]
Keywords: Anti-LYZ, Anti-LZM, Anti-Lysozyme C, EC=3.2.1.17, Anti-1,4-beta-N-acetylmuramidase C, Lysozyme Antibody / LYZ
Supplier-Nr: R32157

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Rat
Immunogen: Amino acids NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ of human LYZ were used as the immunogen for the Lysozyme antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Lysozyme / LYZ"
Write a review
or to review a product.
Viewed