Anti-LIFR

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58828.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Signal-transducing molecule. May have a common pathway with IL6ST. The soluble... more

Close menu

Product information "Anti-LIFR"

Protein function: Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells. [The UniProt Consortium]

Keywords:	Anti-LIFR, Anti-LIF-R, Anti-CD118, Anti-LIF receptor, Anti-Leukemia inhibitory factor receptor
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58828

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: bovine)
Immunogen:	Synthetic peptide corresponding to aa. 863-899 of Human LIFR (EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE)
MW:	124 kD
Format:	Antigen Affinity Purified