Anti-LIF Receptor / LIFR

Anti-LIF Receptor / LIFR
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32098 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIFR also known as CD118 (Cluster of... more
Product information "Anti-LIF Receptor / LIFR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene. Protein function: Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells. [The UniProt Consortium]
Keywords: Anti-LIFR, Anti-CD118, Anti-LIF-R, Anti-LIF receptor, Anti-Leukemia inhibitory factor receptor, LIF Receptor Antibody / LIFR
Supplier-Nr: R32098

Properties

Application: WB
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human
Immunogen: Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-LIF Receptor / LIFR"
Write a review
or to review a product.
Viewed