Anti-HAS1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40286.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent... more

Close menu

Product information "Anti-HAS1"

Protein function: Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction. Also able to catalyze the synthesis of chito- oligosaccharide depending on the substrate. [The UniProt Consortium]

Keywords:	Anti-HAS, Anti-HAS1, Anti-HuHAS1, EC=2.4.1.212, Anti-HA synthase 1, Anti-Hyaluronan synthase 1, Anti-Hyaluronate synthase 1, Anti-Hyaluronic acid synthase 1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40286

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence of Human HAS1. (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)
MW:	65 kD
Format:	Antigen Affinity Purified