Anti-HAS1 / Hyaluronan synthase 1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4648 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Hyaluronan synthase 1 is an enzyme that in... more
Product information "Anti-HAS1 / Hyaluronan synthase 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase. Protein function: Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction. Also able to catalyze the synthesis of chito- oligosaccharide depending on the substrate. [The UniProt Consortium]
Keywords: Anti-HAS, Anti-HAS1, Anti-HuHAS1, EC=2.4.1.212, Anti-HA synthase 1, Anti-Hyaluronan synthase 1, Anti-Hyaluronate synthase 1, Anti-Hyaluronic acid synthase 1, HAS1 Antibody / Hyaluronan synthase 1
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4648

Properties

Application: WB, IHC (paraffin), IF/ICC, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-HAS1 / Hyaluronan synthase 1"
Write a review
or to review a product.
Viewed