Anti-GNAQ

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG10606.50	50 µg		-	-	6 - 14 business days*		528.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or... more

Close menu

Product information "Anti-GNAQ"

Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro). [The UniProt Consortium]

Keywords:	Anti-GAQ, Anti-GNAQ, Anti-Guanine nucleotide-binding protein alpha-q, Anti-Guanine nucleotide-binding protein G(q) subunit alpha
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG10606

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide from Human GNAQ protein. (KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND)
MW:	42 kD
Format:	Antigen Affinity Purified