Anti-ETV4 / Pea3

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58590.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Transcriptional activator that binds to the enhancer of the adenovirus E1A... more

Close menu

Product information "Anti-ETV4 / Pea3"

Protein function: Transcriptional activator that binds to the enhancer of the adenovirus E1A gene, the core-binding sequence is 5'[AC]GGA[AT]GT-3'. [The UniProt Consortium]

Keywords:	Anti-ETV4, Anti-E1AF, Anti-E1A-F, Anti-Protein PEA3, Anti-ETS translocation variant 4, Anti-Adenovirus E1A enhancer-binding protein, Anti-Polyomavirus enhancer activator 3 homolog
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58590

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide corresponding to aa. 1-41 of Human ETV4 / Pea3. (MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD)
MW:	54 kD
Format:	Antigen Affinity Purified