Anti-ETV4 / PEA3

Anti-ETV4 / PEA3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32103 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ETS translocation variant 4 (ETV4), also... more
Product information "Anti-ETV4 / PEA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene. Protein function: Transcriptional activator that binds to the enhancer of the adenovirus E1A gene, the core-binding sequence is 5'[AC]GGA[AT]GT-3'. [The UniProt Consortium]
Keywords: Anti-E1AF, Anti-ETV4, Anti-E1A-F, Anti-Protein PEA3, Anti-ETS translocation variant 4, Anti-Adenovirus E1A enhancer-binding protein, Anti-Polyomavirus enhancer activator 3 homolog, ETV4 Antibody / PEA3
Supplier-Nr: R32103

Properties

Application: WB
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Rat
Immunogen: Amino acids MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD of human PEA3/ETV4 were used as the immunogen for the ETV4 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ETV4 / PEA3"
Write a review
or to review a product.
Viewed