Anti-ETS1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58613.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Transcription factor. Directly controls the expression of cytokine and... more

Close menu

Product information "Anti-ETS1"

Protein function: Transcription factor. Directly controls the expression of cytokine and chemokine genes in a wide variety of different cellular contexts. May control the differentiation, survival and proliferation of lymphoid cells. May also regulate angiogenesis through regulation of expression of genes controlling endothelial cell migration and invasion. [The UniProt Consortium]

Keywords:	Anti-p54, Anti-ETS1, Anti-EWSR2, Anti-Protein C-ets-1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58613

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, goat, guinea pig, horse, rabbit, zebrafish)
Immunogen:	Synthetic peptide around the N-terminal region of Human ETS1. (within the following sequence: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN)
MW:	50 kD
Format:	Purified