Anti-ETS1

Anti-ETS1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32685 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein C-ets-1 is a protein that in... more
Product information "Anti-ETS1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Protein function: Transcription factor. Directly controls the expression of cytokine and chemokine genes in a wide variety of different cellular contexts. May control the differentiation, survival and proliferation of lymphoid cells. May also regulate angiogenesis through regulation of expression of genes controlling endothelial cell migration and invasion. [The UniProt Consortium]
Keywords: Anti-p54, Anti-ETS1, Anti-EWSR2, Anti-Protein C-ets-1, ETS1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32685

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids 67-98 (KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ETS1"
Write a review
or to review a product.
Viewed