Anti-ERV3

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58594.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Retroviral envelope proteins mediate receptor recognition and membrane fusion... more

Close menu

Product information "Anti-ERV3"

Protein function: Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decrease expression of cyclin B1 and increased expression of p21 in vitro. [The UniProt Consortium]

Keywords:	Anti-ERV3, Anti-ERV3-1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58594

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide corresponding to aa. 575-604 of Human ERV3. (LELDDEGKVIKEITAKIQKLAHIPVQTWKG)
MW:	68 kD
Format:	Antigen Affinity Purified