Anti-ERV3 / ERV3-1

Anti-ERV3 / ERV3-1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32228 100 µg - -

3 - 10 business days

503.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HERV-R_7q21.2 provirus ancestral Env... more
Product information "Anti-ERV3 / ERV3-1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma. Protein function: Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decrease expression of cyclin B1 and increased expression of p21 in vitro. [The UniProt Consortium]
Keywords: Anti-ERV3, Anti-ERV3-1, ERV3 Antibody / ERV3-1
Supplier-Nr: R32228

Properties

Application: WB
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human
Immunogen: Amino acids LELDDEGKVIKEITAKIQKLAHIPVQTWKG of human ERV3 were used as the immunogen for the ERV3 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ERV3 / ERV3-1"
Write a review
or to review a product.
Viewed