Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| Cay16687-50 | 50 µg | - |
6 - 10 business days* |
559.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Anti-EP4 (Prostaglandin E4) Receptor (C-Term) conjugated to SureLight(TM) R-PE Antibody: Rabbit... more
Product information "Anti-EP4 Receptor (C-Term):SureLight(TM) R-PE"
Anti-EP4 (Prostaglandin E4) Receptor (C-Term) conjugated to SureLight(TM) R-PE Antibody: Rabbit anti-EP4 Receptor (C-Term) IgG Reactivity: Human, murine, rat, and ovine EP4 receptor, non-reactive with EP1, EP2, and EP3 receptors, other species not tested. Uses: Flow cytometry and fluorescence-activated cell sortingEmission: 660 nm. Excitation: 650 nm. Formulation: (Request formulation change), Lyophilized. Applications: FC, FACS.
| Keywords: | Anti-PTGER2, Anti-PTGER4, Anti-Prostanoid EP4 receptor, Anti-PGE receptor EP4 subtype, Anti-PGE2 receptor EP4 subtype, Anti-Prostaglandin E2 receptor EP4 subtype |
| Supplier: | Cayman Chemical |
| Supplier-Nr: | 16687 |
Properties
| Application: | FC, Cell-Based Assays |
| Conjugate: | Phycoerythrin |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat, sheep |
| Immunogen: | EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) |
| Format: | Lyophilized |
Database Information
| KEGG ID : | K04261 | Matching products |
| UniProt ID : | P35408 | Matching products |
| Gene ID | GeneID 5734 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed