Anti-CD193 / CCR3

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59658.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Receptor for a C-C type chemokine. Binds to eotaxin, eotaxin-3, MCP-3, MCP-4,... more
Product information "Anti-CD193 / CCR3"
Protein function: Receptor for a C-C type chemokine. Binds to eotaxin, eotaxin-3, MCP-3, MCP-4, RANTES and MIP-1 delta. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection. [The UniProt Consortium]
Keywords: Anti-CCR3, Anti-CKR3, Anti-CCR-3, Anti-CD193, Anti-CMKBR3, Anti-CC-CKR-3, Anti-C-C CKR-3, Anti-Eosinophil eotaxin receptor, Anti-C-C chemokine receptor type 3
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59658

Properties

Application: FC, WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human CCR3. (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA)
MW: 41 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CD193 / CCR3"
Write a review
or to review a product.
Viewed