Anti-BMP2

Anti-BMP2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31949 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. BMP2 is also known as Bone morphogenetic... more
Product information "Anti-BMP2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily.BMP-2, like otherbone morphogenetic proteins,plays an important role in the development of bone and cartilage. It is involved in thehedgehog pathway,TGF beta signaling pathway, and incytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation andepithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model. Protein function: Induces cartilage and bone formation (PubMed:3201241). Stimulates the differentiation of myoblasts into osteoblasts via the EIF2AK3-EIF2A- ATF4 pathway. BMP2 activation of EIF2AK3 stimulates phosphorylation of EIF2A which leads to increased expression of ATF4 which plays a central role in osteoblast differentiation. In addition stimulates TMEM119, which upregulates the expression of ATF4 (PubMed:24362451). [The UniProt Consortium]
Keywords: Anti-BMP2, Anti-BMP-2, Anti-BMP2A, Anti-BMP-2A, Anti-Bone morphogenetic protein 2, Anti-Bone morphogenetic protein 2A, BMP2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31949

Properties

Application: WB, IHC (paraffin), ELISA
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-BMP2"
Write a review
or to review a product.
Viewed