Anti-Beta Tubulin, clone 2E11.

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ5619 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tubulin beta chain is a protein that in... more
Product information "Anti-Beta Tubulin, clone 2E11."
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13. Protein function: Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin. [The UniProt Consortium]
Keywords: Anti-TUBB, Anti-TUBB5, Anti-Tubulin beta chain, Anti-Tubulin beta-5 chain, Beta Tubulin Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ5619

Properties

Application: WB, FC, ICC
Antibody Type: Monoclonal
Clone: 2E11.
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: Amino acids EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Beta Tubulin, clone 2E11."
Write a review
or to review a product.
Viewed