IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)

Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.