14 products were found matching "G1SLF2"!

1 from 2 pages
No results were found for the filter!
IL-17A (rabbit) Do-It-Yourself ELISA
IL-17A (rabbit) Do-It-Yourself ELISA

Item number: DIY0963U-003

The Rabbit IL-17A Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit IL-17A ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods...
Keywords: IL17A
Application: ELISA
Species reactivity: rabbit
From 1,098.00€ *
Review
Anti-IL-17A (rabbit)
Anti-IL-17A (rabbit)

Item number: KP0961U-100

IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
Keywords: IL17A
Application: WB, ELISA
Host: Chicken
Species reactivity: rabbit
549.00€ *
Review
Anti-IL-17A (rabbit), Biotin conjugated
Anti-IL-17A (rabbit), Biotin conjugated

Item number: KPB0962U-050

IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
Keywords: IL17A
Application: WB, ELISA
Host: Chicken
Species reactivity: rabbit
549.00€ *
Review
Interleukin 17A (IL17A), partial, rabbit, recombinant
Interleukin 17A (IL17A), partial, rabbit, recombinant

Item number: CSB-EP011597RB.1

Organism: Oryctolagus cuniculus (Rabbit). Source: E.coli. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH HMA....
Keywords: Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial
Application: Activity not tested
Expressed in: E.coli
Origin: rabbit
MW: 42.3 kD
From 364.00€ *
Review
Interleukin 17A (IL17A), partial, rabbit, recombinant
Interleukin 17A (IL17A), partial, rabbit, recombinant

Item number: CSB-YP011597RB.1

Organism: Oryctolagus cuniculus (Rabbit). Source: Yeast. Expression Region: 21-153aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: VKNGIAMPRN PGCPNAEDKN FPQNVKVSLN ILNKSVNSRR PSDYYNRSTS PWTLHRNEDR ERYPSVIWEA KCRHLGCVNA EGNEDHHMNS VPIQQEILVL RRESQHCPHS FRLEKMLVAV GCTCVTPIIH...
Keywords: Interleukin 17A, Recombinant Rabbit Interleukin 17A (IL17A), partial
Application: Activity not tested
Expressed in: Yeast
Origin: rabbit
MW: 17.3 kD
From 407.00€ *
Review
IL-17 Protein, Rabbit, Recombinant (His)
IL-17 Protein, Rabbit, Recombinant (His)

Item number: TGM-TMPY-04609-100ug

Description: IL-17 Protein, Rabbit, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 17.3 kDa and the accession number is G1SLF2.
Keywords: interleukin 17A
MW: 17.3 kD
677.00€ *
Review
IL-17 Protein, Rabbit, Recombinant
IL-17 Protein, Rabbit, Recombinant

Item number: TGM-TMPY-04888-100ug

Description: IL-17 Protein, Rabbit, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.1 kDa and the accession number is G1SLF2.
Keywords: interleukin 17A
MW: 15.1 kD
748.00€ *
Review
NEW
IL-17 Protein, Rabbit, Recombinant (His)
IL-17 Protein, Rabbit, Recombinant (His)

Item number: TGM-TMPY-04609-10ug

Description: IL-17 Protein, Rabbit, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 17.3 kDa and the accession number is G1SLF2.
Keywords: interleukin 17A
MW: 17.3 kD
From 65.00€ *
Review
NEW
IL-17 Protein, Rabbit, Recombinant
IL-17 Protein, Rabbit, Recombinant

Item number: TGM-TMPY-04888-10ug

Description: IL-17 Protein, Rabbit, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 15.1 kDa and the accession number is G1SLF2.
Keywords: interleukin 17A
MW: 15.1 kD
From 73.00€ *
Review
Rabbit Interleukin 17, IL-17 ELISA Kit
Rabbit Interleukin 17, IL-17 ELISA Kit

Item number: CSB-E08058Rb.48

Sample Types: serum, plasma, tissue homogenates Detection Range: 31.25 pg/mL-2000 pg/mL Sensitivity: 7.81 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nm
Keywords: Interleukin 17A
Application: ELISA, Sandwich ELISA
Species reactivity: rabbit
From 421.00€ *
Review
Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A Protein)
Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A...

Item number: 373794.100

Source:, Recombinant protein corresponding to aa21-153 from rabbit Il17a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and...
Keywords: Interleukin 17A
MW: 17,3
From 707.00€ *
Review
IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag (Il17a)
IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag...

Item number: 373779.100

Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA,...
Keywords: Interleukin 17A
MW: 42,3
From 786.00€ *
Review
1 from 2 pages