5 products were found matching "G1SLF2"!
No results were found for the filter!
IL-17A (rabbit) Do-It-Yourself ELISA
Item number: DIY0963U-003
The Rabbit IL-17A Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a Rabbit IL-17A ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods...
| Keywords: | IL17A |
| Application: | ELISA |
| Species reactivity: | rabbit |
From 1,056.00€
*
Anti-IL-17A (rabbit)
Item number: KP0961U-100
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
| Keywords: | IL17A |
| Application: | WB, ELISA |
| Host: | Chicken |
| Species reactivity: | rabbit |
521.00€
*
Anti-IL-17A (rabbit), Biotin conjugated
Item number: KPB0962U-050
IL-17A is a member of the IL-17 family, which is comprised of 6 members [IL-17A, IL-17B, IL-17C, IL-17D, IL-17E (also called IL-25), and IL-17F]. IL-17 family members are involved in numerous immune regulatory functions, including inducing and mediating proinflammatory responses and allergic responses. IL-17 induces...
| Keywords: | IL17A |
| Application: | WB, ELISA |
| Host: | Chicken |
| Species reactivity: | rabbit |
535.00€
*
Il17a, Recombinant, Rabbit, aa21-153, His-Tag (IL-17A...
Item number: 373794.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit Il17a, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA, Storage and...
| Keywords: | Interleukin 17A |
| MW: | 17,3 |
From 675.00€
*
IL-17A Protein, Recombinant, Rabbit, aa21-153, GST-Tag...
Item number: 373779.100
Source:, Recombinant protein corresponding to aa21-153 from rabbit IL-17A Protein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA,...
| Keywords: | Interleukin 17A |
| MW: | 42,3 |
From 636.00€
*
