Anti-ZNF264

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41259.50 50 µl - -

6 - 14 business days*

520.00€
 
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] more
Product information "Anti-ZNF264"
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Keywords: Anti-ZNF264, Anti-KIAA0412, Anti-Zinc finger protein 264
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41259

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: cow, rat, dog, horse, rabbit)
Immunogen: Synthetic peptide around the C-terminal region of Human ZNF264. (within the following region: SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL)
MW: 71 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ZNF264"
Write a review
or to review a product.
Viewed