Anti-VPS4B

Anti-VPS4B
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41263.50 50 µl - -

6 - 14 business days*

520.00€
 
Protein function: Involved in late steps of the endosomal multivesicular bodies (MVB) pathway.... more
Product information "Anti-VPS4B"
Protein function: Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses). VPS4A/B are required for the exosomal release of SDCBP, CD63 and syndecan (PubMed:22660413). [The UniProt Consortium]
Keywords: Anti-SKD1, Anti-MIG1, Anti-VPS4B, EC=3.6.4.6, Anti-Protein SKD1, Anti-Cell migration-inducing gene 1 protein, Anti-Suppressor of K(+) transport growth defect 1, Anti-Vacuolar protein sorting-associated protein 4B
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41263

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: cow, rat, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide located within the following region: EKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQ
MW: 49 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-VPS4B"
Write a review
or to review a product.
Viewed