Anti-UPF3B

Anti-UPF3B
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG43088.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop... more
Product information "Anti-UPF3B"
Protein function: Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC) and serving as link between the EJC core and NMD machinery. Recruits UPF2 at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2-UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. In cooperation with UPF2 stimulates both ATPase and RNA helicase activities of UPF1. Binds spliced mRNA upstream of exon-exon junctions. In vitro, stimulates translation, the function is independent of association with UPF2 and components of the EJC core. [The UniProt Consortium]
Keywords: Anti-UPF3B, Anti-RENT3B, Anti-hUpf3B, Anti-hUpf3B, Anti-hUpf3p-X, Anti-hUpf3p-X, Anti-Nonsense mRNA reducing factor 3B, Anti-Nonsense mRNA reducing factor 3B, Anti-Regulator of nonsense transcripts 3B, Anti-Up-frameshift suppressor 3 homolog B, Anti-Regul
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG43088

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat (Expected: mouse, bovine)
Immunogen: Synthetic peptide corresponding to aa. 416-452 of Human UPF3B. (SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL)
MW: 58 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-UPF3B"
Write a review
or to review a product.
Viewed