Anti-Thrombopoietin / THPO

Anti-Thrombopoietin / THPO
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4662 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Thrombopoietin (THPO), also known as... more
Product information "Anti-Thrombopoietin / THPO"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Thrombopoietin (THPO), also known as megakaryocyte growth and development factor (MGDF), is a protein that in humans is encoded by the THPO gene. Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent. Protein function: Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. [The UniProt Consortium]
Keywords: Anti-ML, Anti-THPO, Anti-MGDF, Anti-C-mpl ligand, Anti-Thrombopoietin, Anti-Megakaryocyte colony-stimulating factor, Anti-Megakaryocyte growth and development factor, Anti-Myeloproliferative leukemia virus oncogene ligand, Thrombopoietin Antibody / THPO
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4662

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQL
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Thrombopoietin / THPO"
Write a review
or to review a product.
Viewed