Anti-TGFB2 / TGF beta 2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4448 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes a secreted ligand of the... more
Product information "Anti-TGFB2 / TGF beta 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing. Protein function: [Transforming growth factor beta-2 proprotein]: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2) chains, which constitute the regulatory and active subunit of TGF-beta-2, respectively. [The UniProt Consortium]
Keywords: Anti-TGFB2, TGFB2 Antibody / TGF beta 2
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4448

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TGFB2 / TGF beta 2"
Write a review
or to review a product.
Viewed