Anti-TFIIH p52

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59647.50 50 µl - -

6 - 14 business days*

520.00€
 
Protein function: Component of the general transcription and DNA repair factor IIH (TFIIH) core... more
Product information "Anti-TFIIH p52"
Protein function: Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre- initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. [The UniProt Consortium]
Keywords: Anti-GTF2H4, Anti-BTF2 p52, Anti-General transcription factor IIH subunit 4, Anti-Basic transcription factor 2 52 kDa subunit, Anti-General transcription factor IIH polypeptide 4, Anti-TFIIH basal transcription factor complex p52 subunit
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59647

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, bovine, dog, goat, guinea pig, rabbit, zebrafish)
Immunogen: Synthetic peptide around the C-terminal region of Human TFIIH p52. (within the following region: LSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS)
MW: 52 kD
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TFIIH p52"
Write a review
or to review a product.
Viewed