Anti-TCP1 gamma / CCT3

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32392 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. T-complex protein 1 subunit gamma is a... more
Product information "Anti-TCP1 gamma / CCT3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8. Protein function: Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis (PubMed:25467444). The TRiC complex mediates the folding of WRAP53/TCAB1, thereby regulating telomere maintenance (PubMed:25467444). As part of the TRiC complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia (PubMed:20080638). The TRiC complex plays a role in the folding of actin and tubulin (Probable). [The UniProt Consortium]
Keywords: Anti-CCT3, Anti-CCTG, Anti-hTRiC5, Anti-CCT-gamma, Anti-TCP-1-gamma, Anti-T-complex protein 1 subunit gamma, TCP1 gamma Antibody / CCT3
Supplier: NSJ Bioreagents
Supplier-Nr: R32392

Properties

Application: WB, FC, IHC (paraffin), IF/ICC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TCP1 gamma / CCT3"
Write a review
or to review a product.
Viewed