Anti-TCF-8 / ZEB1 / AREB6, clone 8B12D1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ7307 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ZEB1 (Zinc Finger E Box-Binding Homeobox... more
Product information "Anti-TCF-8 / ZEB1 / AREB6, clone 8B12D1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ZEB1 (Zinc Finger E Box-Binding Homeobox 1), also called TCF8, AREB6, NIL2A or DELTA-EF1, is a protein that in humans is encoded by the ZEB1 gene. Fluorescence in situ hybridization localized the ZEB1 gene to chromosome 10p11.2. Krafchak et al. (2005) demonstrated a complex (core plus secondary) binding site for TCF8 in the promoter of the COL4A3 gene, mutant in Alport syndrome and which encodes collagen type IV alpha-3. They detected expression of TCF8 in cornea. Nishimura et al. (2006) found that delta-Ef1 was upregulated during differentiation in a mouse smooth muscle cell (SMC) line. Protein function: Acts as a transcriptional repressor. Inhibits interleukin-2 (IL-2) gene expression. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. Represses RCOR1 transcription activation during neurogenesis. Represses transcription by binding to the E box (5'-CANNTG-3'). Promotes tumorigenicity by repressing stemness-inhibiting microRNAs. [The UniProt Consortium]
Keywords: Anti-ZEB1, Anti-AREB6, Anti-TCF-8, Anti-Transcription factor 8, Anti-Negative regulator of IL2, Anti-NIL-2-A zinc finger protein, Anti-Zinc finger E-box-binding homeobox 1, TCF-8 Antibody / ZEB1 / AREB6
Supplier: NSJ Bioreagents
Supplier-Nr: RQ7307

Properties

Application: WB, IHC (paraffin)
Antibody Type: Monoclonal
Clone: 8B12D1
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-TCF-8 / ZEB1 / AREB6, clone 8B12D1"
Write a review
or to review a product.
Viewed