Anti-Synaptopodin / SYNPO

Anti-Synaptopodin / SYNPO
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ5766 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The spine apparatus (SA) is a specialized... more
Product information "Anti-Synaptopodin / SYNPO"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The spine apparatus (SA) is a specialized form of endoplasmic reticulum (ER) that is found in a subpopulation of dendritic spines in central neurons. The SA consists of a series of stacked discs that are though to be connected to each other and to the dendritic system of ER-tubules. The actin binding protein synaptopodin (which has originally been described in podocytes of the kidney) is an essential component of the SA. Mice that lack the gene for synaptopodin do not form a spine apparatus. The SA is believed to play a critical role in learning and memory. In summary, an important function of the spine apparatus is the regulation of plasticity at individual synapses, a process known as metaplasticity. The International Radiation Hybrid Mapping Consortium mapped the SYNPO gene to chromosome 5. Protein function: Actin-associated protein that may play a role in modulating actin-based shape and motility of dendritic spines and renal podocyte foot processes. Seems to be essential for the formation of spine apparatuses in spines of telencephalic neurons, which is involved in synaptic plasticity. [The UniProt Consortium]
Keywords: Anti-SYNPO, Anti-KIAA1029, Anti-Synaptopodin, Synaptopodin Antibody / SYNPO
Supplier: NSJ Bioreagents
Supplier-Nr: RQ5766

Properties

Application: WB, IHC (paraffin), IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids EKPKVTPNPDLLDLVQTADEKRRQRDHGEVGMEEE from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Synaptopodin / SYNPO"
Write a review
or to review a product.
Viewed