Anti-SUGT1 (Suppressor of G2 Allele of SKP1 Homolog, Sgt1, Protein 40-6-3)

Anti-SUGT1 (Suppressor of G2 Allele of SKP1 Homolog, Sgt1, Protein 40-6-3)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
134063.100 100 µg - -

3 - 19 business days*

699.00€
 
Applications:|Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications... more
Product information "Anti-SUGT1 (Suppressor of G2 Allele of SKP1 Homolog, Sgt1, Protein 40-6-3)"
Applications:, Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVG, Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
Supplier: United States Biological
Supplier-Nr: 134063

Properties

Application: ELISA, IF, WB
Antibody Type: Monoclonal
Clone: 6G5
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SUGT1 (Suppressor of G2 Allele of SKP1 Homolog, Sgt1, Protein 40-6-3)"
Write a review
or to review a product.
Viewed