Anti-SCNN1B (Sodium Channel, nonvoltage-gated 1, beta, ENaCb, ENaCbeta, SCNEB)

Anti-SCNN1B (Sodium Channel, nonvoltage-gated 1, beta, ENaCb, ENaCbeta, SCNEB)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
251458.50 50 µl - -

3 - 19 business days*

699.00€
 
Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport... more
Product information "Anti-SCNN1B (Sodium Channel, nonvoltage-gated 1, beta, ENaCb, ENaCbeta, SCNEB)"
Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the beta subunit, and mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), and Liddle syndrome. [provided by RefSeq, Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRTICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 251458

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: SCNN1B (AAH36352.2, 1aa-640aa) full-length human protein.
Format: Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-SCNN1B (Sodium Channel, nonvoltage-gated 1, beta, ENaCb, ENaCbeta, SCNEB)"
Write a review
or to review a product.
Viewed