Anti-RBBP4 / RbAp48, clone 9F3

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59051.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Core histone-binding subunit that may target chromatin assembly factors,... more
Product information "Anti-RBBP4 / RbAp48, clone 9F3"
Protein function: Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair, the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression, the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling, the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development, and the NURF (nucleosome remodeling factor) complex. [The UniProt Consortium]
Keywords: Anti-RBBP4, Anti-RBAP48, Anti-RBBP-4, Anti-CAF-I p48, Anti-CAF-1 subunit C, Anti-CAF-I 48 kDa subunit, Anti-Histone-binding protein RBBP4, Anti-Retinoblastoma-binding protein 4, Anti-Retinoblastoma-binding protein p48
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59051

Properties

Application: IHC (paraffin), WB
Antibody Type: Monoclonal
Clone: 9F3
Conjugate: No
Host: Mouse
Species reactivity: human (Expected: mouse, rat)
Immunogen: Synthetic peptide corresponding to aa. 395-425 of Human RbAp48 (EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS)
MW: 48 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RBBP4 / RbAp48, clone 9F3"
Write a review
or to review a product.
Viewed