Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
ARG59051.50 | 50 µg | - | - |
6 - 14 business days* |
520.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: Core histone-binding subunit that may target chromatin assembly factors,... more
Product information "Anti-RBBP4 / RbAp48, clone 9F3"
Protein function: Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair, the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression, the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling, the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development, and the NURF (nucleosome remodeling factor) complex. [The UniProt Consortium]
Keywords: | Anti-RBBP4, Anti-RBAP48, Anti-RBBP-4, Anti-CAF-I p48, Anti-CAF-1 subunit C, Anti-CAF-I 48 kDa subunit, Anti-Histone-binding protein RBBP4, Anti-Retinoblastoma-binding protein 4, Anti-Retinoblastoma-binding protein p48 |
Supplier: | Arigo Biolaboratories |
Supplier-Nr: | ARG59051 |
Properties
Application: | IHC (paraffin), WB |
Antibody Type: | Monoclonal |
Clone: | 9F3 |
Conjugate: | No |
Host: | Mouse |
Species reactivity: | human (Expected: mouse, rat) |
Immunogen: | Synthetic peptide corresponding to aa. 395-425 of Human RbAp48 (EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS) |
MW: | 48 kD |
Format: | Antigen Affinity Purified |
Database Information
KEGG ID : | K10752 | Matching products |
UniProt ID : | Q09028 | Matching products |
Gene ID | GeneID 5928 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed