Anti-RAB13

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59040.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking,... more
Product information "Anti-RAB13"
Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in endocytic recycling and regulates the transport to the plasma membrane of transmembrane proteins like the tight junction protein OCLN/occludin. Thereby, it regulates the assembly and the activity of tight junctions. Moreover, it may also regulate tight junction assembly by activating the PKA signaling pathway and by reorganizing the actin cytoskeleton through the activation of the downstream effectors PRKACA and MICALL2 respectively. Through its role in tight junction assembly, may play a role in the establishment of Sertoli cell barrier. Plays also a role in angiogenesis through regulation of endothelial cells chemotaxis. Also involved in neurite outgrowth. Has also been proposed to play a role in post-Golgi membrane trafficking from the TGN to the recycling endosome. Finally, it has been involved in insulin- induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore may play a role in glucose homeostasis. [The UniProt Consortium]
Keywords: Anti-GIG4, Anti-RAB13, Anti-Ras-related protein Rab-13, Anti-Cell growth-inhibiting gene 4 protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59040

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: hamster)
Immunogen: Synthetic peptide corresponding to aa. 121-150 of Human RAB13 (NKCDMEAKRKVQKEQADKLAREHGIRFFET)
MW: 23 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-RAB13"
Write a review
or to review a product.
Viewed