Anti-PRMT2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59652.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Arginine methyltransferase that methylates the guanidino nitrogens of arginyl... more

Close menu

Product information "Anti-PRMT2"

Protein function: Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1- dependent manner). May be involved in growth regulation. [The UniProt Consortium]

Keywords:	Anti-HMT1, Anti-PRMT2, Anti-Protein arginine N-methyltransferase 2, Anti-Histone-arginine N-methyltransferase PRMT2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59652

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse (Expected: bovine, rat, dog, guinea pig, horse, swine, rabbit)
Immunogen:	Synthetic peptide around the N-terminal region of Human PRMT2. (within the following region: ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL)
MW:	48 kD
Format:	Purified