Anti-Peptide YY

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40991.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory... more

Close menu

Product information "Anti-Peptide YY"

Protein function: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility. [The UniProt Consortium]

Keywords:	Anti-Pyy
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40991

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 29-64 of Mouse Peptide YY (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY)
MW:	11 kD
Format:	Antigen Affinity Purified