Anti-PC4 / Positive cofactor 4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32566 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Activated RNA polymerase II... more
Product information "Anti-PC4 / Positive cofactor 4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Activated RNA polymerase II transcriptional coactivator p15, also known as Positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs. Protein function: General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA). [The UniProt Consortium]
Keywords: Anti-PC4, Anti-p14, Anti-SUB1, Anti-SUB1 homolog, Anti-Positive cofactor 4, Anti-Activated RNA polymerase II transcriptional coactivator p15, PC4 Antibody / Positive cofactor 4
Supplier: NSJ Bioreagents
Supplier-Nr: R32566

Properties

Application: WB, IHC (paraffin), IF
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: amino acids 96-127 (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-PC4 / Positive cofactor 4"
Write a review
or to review a product.
Viewed